Description
Overview
| Product name | WIF1 Rabbit pAb |
|---|---|
| Catalog No. | A5386 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
The protein encoded by this gene functions to inhibit WNT proteins, which are extracellular signaling molecules that play a role in embryonic development. This protein contains a WNT inhibitory factor (WIF) domain and five epidermal growth factor (EGF)-like domains, and is thought to be involved in mesoderm segmentation. This gene functions as a tumor suppressor gene, and has been found to be epigenetically silenced in various cancers.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 307-377 of human WIF1 (NP_009122.2). |
|---|---|
| Sequence | KPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHTPSLKKAEERRDPPESNY |
| Gene ID | |
| Swiss Prot | |
| Synonyms | WIF-1 |
| Calculated MW | 42kDa |
| Observed MW | 42KDa |
Applications
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | HeLa |
| Cellular location | Secreted |
Research Area
WIF1 Rabbit pAb images
Western blot analysis of HeLa, using WIF1 antibody (A5386) at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 60s.
Immunofluorescence analysis of NIH/3T3 cells using WIF1 Rabbit pAb (A5386) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using WIF1 Rabbit pAb (A5386) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
* For research use only. Not for therapeutic or diagnostic purposes.
