Description
Overview
| Product name | CD48 Rabbit pAb |
|---|---|
| Catalog No. | A5396 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
This gene encodes a member of the CD2 subfamily of immunoglobulin-like receptors which includes SLAM (signaling lymphocyte activation molecules) proteins. The encoded protein is found on the surface of lymphocytes and other immune cells, dendritic cells and endothelial cells, and participates in activation and differentiation pathways in these cells. The encoded protein does not have a transmembrane domain, however, but is held at the cell surface by a GPI anchor via a C-terminal domain which maybe cleaved to yield a soluble form of the receptor. Multiple transcript variants encoding different isoforms have been found for this gene.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 45-210 of human CD48 (NP_001769.2). |
|---|---|
| Sequence | ISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVC |
| Gene ID | |
| Swiss Prot | |
| Synonyms | BCM1; BLAST; hCD48; mCD48; BLAST1; SLAMF2; MEM-102 |
| Calculated MW | 28kDa |
| Observed MW | 45kDa |
Applications
| Reactivity | Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.01% thiomersal, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | Mouse pancreas, Mouse spleen, Rat pancreas |
| Cellular location | Cell membrane, GPI-anchor, Lipid-anchor |
Research Area
CD48 Rabbit pAb images
Western blot analysis of extracts of various cell lines, using CD48 antibody (A5396) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 5 min.
* For research use only. Not for therapeutic or diagnostic purposes.
